Skip Navigation

This Article
Right arrow Abstract Freely available
Right arrow FREE Full Text (PDF) Freely available
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Services
Right arrow Email this article to a friend
Right arrow Similar articles in this journal
Right arrow Similar articles in ISI Web of Science
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Add to My Personal Archive
Right arrow Download to citation manager
Right arrow Search for citing articles in:
ISI Web of Science (116)
Right arrowRequest Permissions
Google Scholar
Right arrow Articles by Weenen, C.
Right arrow Articles by Themmen, A. P.N.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Weenen, C.
Right arrow Articles by Themmen, A. P.N.
Social Bookmarking
 Add to CiteULike   Add to Connotea   Add to Del.icio.us  
What's this?

Molecular Human Reproduction, Vol. 10, No. 2, pp. 77-83, 2004
© European Society of Human Reproduction and Embryology 2004

Anti-Müllerian hormone expression pattern in the human ovary: potential implications for initial and cyclic follicle recruitment

Christien Weenen1,4, Joop S.E. Laven1, Anne R.M. von Bergh1, Mark Cranfield3, Nigel P. Groome3, Jenny A. Visser2, Piet Kramer2, Bart C.J.M. Fauser1 and Axel P.N. Themmen2

1Division of Reproductive Medicine, Department of Obstetrics and Gynaecology and 2Department of Internal Medicine, Erasmus MC, 3015 GD Rotterdam, The Netherlands and 3School of Biological Sciences, Oxford Brookes University, Headington, Oxford OX3 0BP, UK

4 To whom correspondence should be addressed: c.weenen{at}erasmusmc.nl


    ABSTRACT
 Top
 ABSTRACT
 Introduction
 Materials and methods
 Results
 Discussion
 REFERENCES
 
Anti-Müllerian hormone (AMH) is a member of the transforming growth factor-ß superfamily, which plays an important role in both ovarian primordial follicle recruitment and dominant follicle selection in mice. However, the role of AMH in folliculogenesis in humans has not been investigated in detail. In the present study, AMH expression was assessed using immunohistochemistry in ovarian sections, obtained from healthy regularly cycling women. To this end, a novel monoclonal antibody to human AMH was developed. AMH expression was not observed in primordial follicles, whereas 74% of the primary follicles showed at least a weak signal in the granulosa cells. The highest level of AMH expression was present in the granulosa cells of secondary, preantral and small antral follicles ≤4 mm in diameter. In larger (4–8 mm) antral follicles, AMH expression gradually disappeared. In conclusion, in the human AMH expression follows a similar pattern as compared to the mouse and rat, suggesting an important role of AMH in folliculogenesis.

Key words: Key words: Anti-Müllerian hormone/folliculogenesis/primordial follicle recruitment


    Introduction
 Top
 ABSTRACT
 Introduction
 Materials and methods
 Results
 Discussion
 REFERENCES
 
Anti-Müllerian hormone (AMH), also referred to as Müllerian inhibiting substance (MIS), is a transforming growth factor-ß family member which is involved in regulation of folliculogenesis (Grootegoed et al., 1994; Baarends et al., 1995). During male fetal sex differentiation, AMH is synthesized by testicular Sertoli cells and induces degeneration of the Müllerian derivatives that form the anlagen of the oviducts, the uterus and the upper part of the vagina (Josso et al., 1977, 1998). During mouse and rat female fetal development, no ovarian AMH activity can be detected, but AMH mRNA expression is present in ovarian granulosa cells as early as day 4 after birth, coinciding with the initiation of primary follicle growth (Ueno et al., 1989a,b; Durlinger et al., 2002a). Immunohistochemistry and mRNA in situ hybridization (ISH) studies in rodents and sheep revealed specific expression of AMH in granulosa cells of early growing, preantral and small antral follicles, whereas the signal was lost in non-atretic large antral follicles and all atretic follicles (Bezard et al., 1987; Baarends et al., 1995). In human fetal and neonatal ovarian tissue, AMH expression is not detected before 36 weeks of gestation (Rajpert-De Meyts et al., 1999). Data on postnatal expression are lacking.

Follicle growth and differentiation is a complex process. The initiation of growth and early differentiation appears to be regulated independently of stimulation by gonadotrophins as indicated by the presence of preantral follicles in FSH knockout (FSHKO) mice. At later stages, growth and differentiation and the selection of the cohort are largely dependent on FSH activity (Fauser and van Heusden, 1997). Two important regulation steps can be identified (McGee and Hsueh, 2000); the initiation of growth of follicles from the primordial pool (initial recruitment) and rescue of the growing follicles from atresia (cyclic recruitment). The gonadotrophin FSH is an essential factor in cyclic recruitment as indicated by the absence of antral follicles in ovaries of FSHKO mice (Kumar et al., 1997; Durlinger et al., 2001) and absence of large antral follicles in hypophysectomized women (Schoot et al., 1992). Some of the factors involved in the regulation of the initiation of growth of primordial follicles (initial recruitment) have been identified and include factors such as kit-ligand (SCF) (Parrott and Skinner, 1999) and nerve growth factor (NGF) (Dissen et al., 2001).

Studies in AMH knockout (AMHKO) mice indicate that AMH exhibits an inhibitory effect on initial follicle recruitment. Immediately after birth, a normal-sized primordial follicle stock has been formed in AMHKO animals, but depletion of the primordial follicle pool is accelerated, resulting in premature cessation of the estrus cycle (Durlinger et al., 1999). Moreover, ovarian follicles of AMHKO mice treated in vivo with exogenous FSH appear to be more sensitive to FSH compared with follicles from wild type mice, resulting in an increased number of follicles reaching the ovulatory stage compared with wild type mice (Durlinger et al., 1999, 2001). These findings suggest an involvement of AMH in mouse primordial follicle selection and growing follicle cyclic recruitment.

Since it is unknown whether AMH plays a similar role in human folliculogenesis, we have investigated the expression pattern of AMH using immunohistochemistry, in human ovaries.


    Materials and methods
 Top
 ABSTRACT
 Introduction
 Materials and methods
 Results
 Discussion
 REFERENCES
 
Subjects
This study was approved by the Ethics Review Committee of Erasmus MC and informed consent was obtained from all subjects. All subjects had undergone surgery in the period 1998–2002. Uni- or bilateral oophorectomy was performed because subjects were carrying a gene mutation (BRCA1 or 2), because family history indicated a severe increase of the incidence of ovarian cancer (Blanchard and Hartmann, 2000) or because of other gynaecological conditions. Only women with a regular menstrual cycle (interval 21–35 days) and aged <46 years were included. Women with polycystic ovaries were excluded. Similarly, if ovarian cancer was present in one or both ovaries, patients were excluded.

Formalin-fixed paraffin-embedded ovarian tissue blocks were collected either from the Pathology Department of the Erasmus MC (Rotterdam, The Netherlands) or from the Pathology Department of MC Rotterdam-Zuid (Rotterdam, The Netherlands).

Ovarian morphology
After oophorectomy, tissue segments were fixed for 24 h in formalin and subsequently embedded in paraffin. Histological examination was carried out to exclude ovarian pathology. For the present study, the haematoxilin and eosin-stained (HE) sections of each tissue segment were re-examined. Samples that did not contain any follicles >2 mm in size or had poor morphology were excluded. Of each evaluated tissue sample, 150 fresh 4 µm serial sections were mounted on Starfrost microscopic glass slides (Menzel-Glaser, Germany). Every fifth slide was stained with HE and evaluated for follicle stages to use for the experiment and stored at 4°C. Follicular size was calculated by measuring two perpendicular diameters as described before (van Cappellen et al., 1989). Adjacent sections were used for immunostaining.

Follicles were grouped according to the classification proposed by Gougeon (1986): primordial follicles (oocyte with one layer of flat pre-granulosa cells), primary follicles (oocyte with one layer of cuboidal granulosa cells), small secondary follicles (two to six layers of granulosa cells, no theca cells), preantral follicles (class 1), and antral follicle stages (antrum formation is present) with diameters <1 mm (classes 2 and 3), 1–2 mm (class 4), 2–4 mm (class 5), 4–6 mm, 6–8 mm (class 6) and >8 mm (class 7). The criteria for an atretic follicle are nuclear pyknosis and disappearance of granulosa cells.

Immunohistochemistry of AMH
Since the specificity and sensitivity of the detection of immunohistochemical staining of AMH is largely dependent on the quality of the first antibody, we decided to use two different, completely independently developed antibodies. The first, MIS C-20 (Santa Cruz Biotechnology, USA), was a commercially available goat polyclonal anti-AMH antibody. The second, a mouse monoclonal antibody, was specifically developed using the C-terminal 32 amino acids of human AMH. The use of these independently obtained antibodies ensures specific detection of the AMH expression in the ovaries.

For the development of the mouse monoclonal antibody, a synthetic peptide was synthesized corresponding to a peptide sequence close to the C-terminus of human AMH, VPTAYAGKLLISLSEERISAHHVPNMVATECG, and coupled to a purified protein derivative of tuberculin (Groome and Lawrence, 1991). Outbred Tyler’s Original (T/O) mice (Southend on Sea, Essex, UK) underwent an immunization regime over a 4 month period. The animals were killed and their spleens removed for fusion to SP2/0 murine myeloma cells, following a standard protocol (Goding, 1986). The hybridoma supernatants were initially screened by enzyme-linked immunosorbent assay using standard protocols (Harlow and Lane, 1988), against recombinant human AMH coated to Nunc immunoplates using 0.2 mol/l bicarbonate buffer pH 9.4 as diluent for the AMH. Reactive clones were expanded and recloned by limiting dilution. Supernatants were then titrated against recombinant AMH and the best reacting clones were selected, expanded and isotyped. As each clone was found to be IgG1, all were purified on a protein A column using a high salt protocol (Harlow and Lane, 1988) before assessment. Clone 5/6A was selected after screening on rat and mouse ovarian sections using immunohistochemistry.

Immunohistochemical staining was performed on the stored 4 µm thick formalin-fixed paraffin-embedded tissue sections according to standard procedures (Durlinger et al., 2002a). After deparaffinization, the sections were quenched for 20 min in 3% H2O2/methanol solution to block endogenous peroxidase activity. Subsequently the sections were pretreated by 15 min heating in 0.01 mol/l citric acid buffer (pH 6) in a microwave oven at 700 W. After cooling for 30–45 min at room temperature, the sections set up for staining with MIS C-20 were rinsed in phosphate-buffered saline (PBS) and incubated for 15 min at room temperature with normal rabbit serum in 5% (w/v) bovine serum albumin (BSA) in PBS (Dako, Denmark). The preincubation step was followed by incubation at 4°C overnight with primary polyclonal antibody MIS C-20 diluted 1:1000 in 5% BSA in PBS. After incubation, the sections were rinsed in PBS and subsequently treated for 30 min at room temperature with biotinylated rabbit anti-goat antibody (dilution 1:400; Dako). This was followed by incubation for 30 min with streptavidin–biotin–peroxidase complex (diluted 1:200 in PBS; Dako) and colour development for 4 min with 0.075% 3,3'-diaminobenzidine tetrahydrochloride (Sigma–Aldrich, USA) at room temperature.

After pretreatment, the sections scheduled for staining with 5/6A were incubated with normal goat serum in 5% BSA for 30 min at room temperature. This was followed by incubation at 4°C overnight with primary monoclonal antibody 5/6A, diluted 1:500. After incubation, the sections were rinsed in PBS and subsequently treated for 15 min at room temperature with biotinylated goat anti-mouse antibody (dilution 1:400; Dako). The same colour development procedure was used. After immunostaining, sections were counterstained with haematoxylin for 3 min.

For each section, the adjacent section was incubated with 5% BSA/PBS in the absence of the primary antibody (negative control). To validate the specificity of the 5/6A antibody, a preabsorption experiment was performed. The 5/6A antibody (0.67 g/l) was combined with a 5-fold excess (by weight) of the peptide, which was used for the development of the 5/6A antibody (see above). The 5/6A antibody with the blocking peptide (final dilution 1:500) and the 5/6A alone (dilution 1:500) were incubated at 4°C overnight. Adjacent sections were incubated with 5/6A, 5/6A with blocking peptide or 5% BSA/PBS (negative control), using the procedure described above.

Mouse ovarian tissue was used as a positive control since the expression pattern of AMH in these animals has been well described (Durlinger et al., 2002a). Sections were analysed and scored using a Zeiss Axioplan 2 microscope (Germany). Granulosa cells of each follicle were scored negative (–) if absolutely no staining was present as compared to adjacent control tissue sections. If staining was present in only some granulosa cells, the follicle was scored ‘weakly positive’ (+/–). Follicles were scored positive (+) if specific AMH staining was present in almost all or all granulosa cells. When granulosa cells of a single follicle stained much stronger than granulosa cells in other follicles in the same slide, this follicle was scored strongly positive (++). The absolute intensity of staining varied between experiments, but the relative intensity of signals in the different follicle classes remained similar. Pictures were taken using a Coolsnap Pro Color camera and ImagePro® Plus software (Media Cybernetics, Inc., USA). Using a multivariate analysis of variance the number of follicles within each class that stained for AMH with MIS C-20 was compared with the number of follicles within each class that stained for AMH with 5/6A.

Human AMH production and western blot analysis
Full length human AMH cDNA was isolated from human testis by RT–PCR using the primers 5'-CTCGAGCTGCCAGGGACAGAAAGGGCT-3' and 5'-CTCGAGTTGCTGGTCTTTATTGGGGCG-3'. The hAMH cDNA was fully sequenced, compared with the published sequence (Cate et al., 1986), and subcloned into the pcDNA3.1 expression vector (Invitrogen, The Netherlands). To allow efficient hormone processing in HEK293 cells, an optimized cleavage site (RARR) was created by quick change site-directed mutagenesis according to the manufacturer (Stratagene Europe, The Netherlands) as described previously (Nachtigal and Ingraham, 1996). A 6HIS epitope tag was introduced into hAMH at position Pro-30 by site-directed mutagenesis. Human embryonic kidney 293 (HEK293) cells were stably transfected with the cDNA encoding the modified hAMH. Recombinant bioactive AMH ligand was obtained from conditioned media collected from stably transfected HEK293 cells expressing modified hAMH as described (Durlinger et al., 2002a). AMH was purified from the medium using the NiNTA superflow Ni-column (Qiagen, The Netherlands). Subsequently, AMH was eluted from the column using Hanks’ balanced salt solution (HBSS) (Gibco BRL, Invitrogen, The Netherlands) containing 250 nmol/l imidazole (Sigma-Aldrich Chemie BV, The Netherlands) and stored in siliconized tubes (Biozym, The Netherlands) in the presence of 0.1% BSA. Finally, AMH was desalted over a PD10 column (Amersham Pharmacia Biotech, The Netherlands) to remove the imidazole. Ni-column elution buffer run through a PD10 column constituted the control medium. Samples were stored at –20°C.

Western blot analysis was performed using the mouse monoclonal antibody 5/6A. Proteins from conditioned medium were separated using 12% polyacrylamide gel electrophoresis under reducing conditions. Proteins were transferred to nitrocellulose membrane and incubated with the 5/6A antibody at a 1:500 dilution, followed by a secondary peroxidase-conjugated goat anti-mouse antibody (Sigma-Aldrich Chemie BV, The Netherlands) at a 1:10 000 dilution. Proteins were visualized by ECL plus western blotting detection system (Amersham Biosciences, The Netherlands).


    Results
 Top
 ABSTRACT
 Introduction
 Materials and methods
 Results
 Discussion
 REFERENCES
 
Subjects
Tissue blocks from 12 different subjects were included. These ovaries were collected from regularly cycling women with ages ranging from 19 to 44 years, median 36 (Table I). All ovaries were of normal size. Seven patients underwent a prophylactic bilateral oophorectomy. Five were carriers of gene mutations (four BRCA1 and one BRCA2). Two subjects had a positive family history of breast and ovarian cancer without a BRCA1/BRCA2 gene mutation. Two patients underwent a unilateral oophorectomy because of endometriosis, where the ovaries were not affected, two because of a hysterectomy and one because of a benign cyst. Data regarding patients’ last menstrual period preceding surgery are lacking since most patients did not recall this date precisely.


View this table:
[in this window]
[in a new window]
 
Table I. Clinical data of all subjects
 
Ovarian morphology
The mean number of follicles in each sample differed considerably (mean MIS C-20 34.5 and mean 5/6A 25.9). Due to the age of the subjects (median age 36 years), the number of follicles with a diameter >6 mm was low (n = 8). No follicles with a diameter >10 mm were found. Specific stain deposition only occurred in the cytoplasm of granulosa cells. Oocytes of follicles in both control and antibody-incubated sections did show a weak, non-specific, brown staining.

Immunohistochemistry of AMH
Both antibodies revealed identical staining patterns, both in terms of intensity and specificity, when tested on mouse ovary sections (data not shown). Subsequently, we applied the antibody on the human material in this study. Addition of the peptide, used for development of the 5/6A antibody, showed elimination of the immunohistochemical staining (Figure 1K) and therefore validates the specificity of this novel antibody.



View larger version (115K):
[in this window]
[in a new window]
 
Figure 1. Micrographs of anti-Müllerian hormone (AMH) immunohistochemical stained human ovarian tissue sections. Specific (brown) AMH stain deposition is present in the cytoplasm of granulosa cells. Scale bar = 100 µm. Sections A, D and G are controls; sections B, E and H were stained using the MIS C-20 antibody; sections C, F and I using the 5/6A antibody. (AC) Adjacent sections at x100 magnification with a primordial follicle (arrowhead), a primary follicle (small arrow) and a secondary follicle (large arrow). Primordial follicles show no immunostaining of the cytoplasma of the granulosa cells, whereas the primary follicles show normal staining (+) with both the MIS C-20 and 5/6A antibodies. Secondary follicle shows strong staining (++) with both antibodies. (DF) Adjacent sections at x40 magnification with a small antral follicle <1 mm. The oocyte shows weak, non-specific brown staining (arrowhead), whereas the granulosa cells, especially of the cumulus (arrow), show strong staining (++) with both antibodies. (GI) Adjacent sections at x100 magnification showing two larger antral follicles. The follicle on the left side with a diameter of 6.1 mm shows weak staining (+/–) of the granulosa cells (arrowhead), whereas the smaller follicle on the right side (arrow) with a diameter of 2.5 mm shows normal staining (+) with both antibodies. (JL) Adjacent sections at x40 magnification with a small antral follicle <1 mm. The oocyte shows weak, non-specific brown staining (arrowhead). The granulosa cells show strong staining (++) with the 5/6A antibody. When the peptide is added to the antibody, no immunohistochemical staining occurs (K).

 
The results of the immunohistochemical detection of AMH in the human ovaries are shown in two ways. In Figure 1, examples are given of the staining patterns and intensity in individual follicles of different classes. In Tables II and III and in Figure 2, the results of the quantitative determinations of numbers of follicles are given.


View this table:
[in this window]
[in a new window]
 
Table II. Number of follicles scored for all subjects after immunostaining with MIS C-20
 

View this table:
[in this window]
[in a new window]
 
Table III. Number of follicles scored for all subjects after immunostaining with 5/6A
 


View larger version (20K):
[in this window]
[in a new window]
 
Figure 2. Graphical summary of the immunohistochemical data in Tables II and III. Only the percentages of follicles with strong (++) and total staining (+ and ++) are shown. The total staining in the graphical depictions represents an addition of the percentage of follicles within a certain class with normal (+) and strong (++) staining (total staining; triangles). For comparison the percentage of follicles of a certain class that show strong staining is depicted separately (strong staining; squares). Staining increases rapidly with the stage of the follicles and decreases when follicles are >4–6 mm. In the upper graph (A), staining with the MIS antibody is shown. In the lower graph (B), staining with the novel 5/6A antibody is shown.

 
In all primordial follicles examined, AMH expression was absent (Figure 1B and C; Tables II and III). AMH immunostaining could first be observed in granulosa cells of follicles in the primary stage. Approximately 75% of secondary follicles with two to six granulosa cell layers were positive or strongly positive for AMH immunostaining (Figure 1B and C). The strongest staining was observed in preantral (more than six GC layers) and small antral follicles ≤4 mm (Figure 1E and F). In these follicle classes, all granulosa cells were positive (Table II and III). This was observed with both the polyclonal and monoclonal anti-AMH antibodies.

AMH staining disappears rapidly with increasing follicle size (Figure 1H and I), with AMH staining being almost lost in follicles with a diameter >8 mm. These follicles show very weak staining of the granulosa cells, which was almost exclusively restricted to the cumulus granulosa cells. All atretic follicles showed no immunohistochemical staining. No corpora lutea were present in the sections. There was no statistically significant difference between the number of follicles that stained for AMH between the two different antibodies (P = 0.8).

Human AMH production and western blot analysis
For further validation of the novel antibody 5/6A, a western blot analysis was performed. No AMH protein was detected in the control medium and in concentrated medium of COV343 cells, a human granulosa tumour cell line (Figure 3) which does not express AMH mRNA (J.Visser, unpublished observations). Purified recombinant rat AMH, purified recombinant human AMH as well as non-purified hAMH in concentrated medium of hAMH-producing HEK293 cells is detected by this novel antibody.



View larger version (50K):
[in this window]
[in a new window]
 
Figure 3. Detection of anti-Müllerian hormone (AMH) with the mouse monoclonal antibody 5/6A. No AMH protein is detected in the control medium (lane 1) and in concentrated medium of COV434 cells, a human granulosa tumour cell line (lane 5). The 5/6A antibody detects purified recombinant rAMH (lane 2), purified recombinant hAMH (lane 3), and non-purified AMH in concentrated medium of hAMH-producing HEK293 cells (lane 4). Upon purification, a stable AMH dimer is formed. Relative molecular mass (kDa) of the standards is indicated on the right.

 

    Discussion
 Top
 ABSTRACT
 Introduction
 Materials and methods
 Results
 Discussion
 REFERENCES
 
In the present study, the AMH protein expression pattern in granulosa cells of follicles in human adult ovaries was investigated. Immunoreactive AMH protein was observed in primary follicles and continued to be expressed in follicles in the antral stage. The highest level of AMH expression was present in granulosa cells of secondary, preantral and small antral follicles ≤4 mm in diameter. In larger (4–8 mm) antral follicles, the AMH expression gradually disappeared. The almost identical patterns obtained with two different antibody tools, a goat polyclonal and a newly developed mouse monoclonal antibody, indicate the value of these observations.

This pattern of AMH immunostaining is comparable to that previously found in human fetal and postnatal ovarian tissue (Rajpert-De Meyts et al., 1999). In that study, however, the emphasis was not on AMH expression in different stages of normal folliculogenesis, but rather on ovaries in different stages of development and under different disease conditions (Rajpert-De Meyts et al., 1999).

From our previous mouse and rat studies, it became apparent that AMH plays an important role during both initial and cyclic recruitment of ovarian follicles. AMH, produced by the pool of growing follicles, acts as a feedback signal by inhibiting the initial recruitment of primordial follicles (Durlinger et al., 2002b). In the rat, AMH expression negatively correlates with future atresia of follicles that undergo selection, suggesting that AMH may be involved in the process of cyclic recruitment (A.L.Durlinger, unpublished thesis, 2000). In addition, we found that FSH-dependent growth of mouse follicles in vitro is attenuated by the addition of AMH to the culture, indicating that AMH is one of the factors determining the sensitivity of ovarian follicles to FSH (Durlinger et al., 2001). This role of AMH is underlined by its characteristic pattern of expression in the mouse and rat ovary. As soon as primordial follicles are recruited for growth, AMH is expressed in the first differentiating granulosa cells indicated by a change from flat to cuboidal. AMH expression is lost in rat and mouse follicles during the stage at which they undergo cyclic recruitment, i.e. large preantral and small antral follicles.

The role of AMH in initial and cyclic recruitment might be similar in the human ovary, since the pattern of expression of AMH in human follicles is similar to that of rodents and sheep. From the primary stage onwards, all follicles express AMH, whereas expression is lost from follicles at sizes >8 mm. Thus, also in the human, the pool of growing follicles produces AMH, which could act on the remaining primordial follicles, inhibiting their recruitment. In addition, AMH expression in the human disappears in large-sized antral follicles (6–8 mm), which are the follicles that undergo cyclic recruitment (Fauser and van Heusden, 1997). Interestingly, AMH expression in these follicles was the strongest in the granulosa cells of the cumulus, similar to the pattern found in rat and mouse (Baarends et al., 1995; Durlinger et al., 2002b). In the human ovary, a cohort of small healthy antral follicles that reaches a diameter of 3–5 mm, and that has just become dependent on FSH for further growth, will grow into larger antral follicles (6–8 mm) once a certain threshold level of serum FSH is reached (Pache et al., 1990). Only a single follicle from this cohort is selected to gain dominance and ovulate every cycle (van Santbrink et al., 1995; Fauser and van Heusden, 1997). Since we could not study follicles >10 mm, the question whether AMH expression is lost in the follicles that are selected for dominance remains unanswered. However, the increasingly lower expression that is found in the larger follicle classes suggests that this may be the case.

Since AMH may be involved in initial and cyclic recruitment, it is of great interest to investigate the role of AMH in diseases associated with ovarian dysfunction. Indeed, in women with polycystic ovary syndrome (PCOS), a chronic anovulatory disorder (World Health Organization classification 2), serum AMH levels appear to be strongly increased (Cook et al., 2002; Laven et al., 2003). Normogonadotrophic anovulatory infertility appears to be caused by disturbed dominant follicle selection. The size of the population of antral follicles is increased, while the number of primary and secondary follicles in the polycystic ovary are about twice those observed in the normal ovary. Thus, it would be of great interest to investigate the AMH expression pattern in ovarian tissue collected from women with this anovulatory disorder.

AMH has also been shown to be an excellent marker for ovarian ageing (de Vet et al., 2002; van Rooij et al., 2002). The number of follicles in the ovary of a woman reaching the end of her reproductive period is the major determinant of the timing of both the period prior to menopause and menopause itself. Serum levels of AMH in regularly cycling women decrease over time and there is a strong correlation between AMH and the number of antral follicles (de Vet et al., 2002; van Rooij et al., 2002). It appears that the size of the recruited cohort of follicles is closely linked to the remaining primordial follicle pool. Post-menopausal women are infertile due to the exhaustion of the primordial follicle pool, whereas women in the years before menopause, whose ovaries still contain follicles, have a reduced fertility of which the cause is not completely known (Richardson and Nelson, 1990; Te Velde and Pearson, 2002). Through its inhibitory effect on primordial follicle recruitment, AMH may regulate the efficiency of the use of the primordial follicle pool and therefore may be involved in the determination of the age at which menopause arises. The pattern of AMH immunostaining as observed in the present study is supportive of the suggestion of an inhibitory role of AMH in follicle recruitment. Another argument in favour of this inhibitory role of AMH is the observation of an accelerated depletion of resting follicles in women in the 35–45 year old age group, when the levels of AMH decrease rapidly as a result of a strongly diminished number of growing follicles.

In conclusion, the pattern of AMH immunostaining in the human ovary suggests a role of AMH in both the processes of initial and cyclic recruitment. These results confirm for the first time previous observations in the rat and mouse and may be of great importance for the role of dysregulation of AMH function as a cause of female infertility, and the possible treatment.


    Acknowledgements
 
The authors gratefully acknowledge Dr Patricia Ewing (Department of Pathology, Erasmus MC (Rotterdam, The Netherlands) for her advice regarding the morphological examination of all tissue samples, Dr Richard Cate, Biogen, Cambridge, MA, USA for his kind gift of human recombinant AMH, Bas Karels for assistance with the histology and Annemarie de Vet for her preliminary work. This work was financially supported by a research grant from Organon NV (EMF fonds 2764005), the Stichting Voortplantingsgeneeskunde Rotterdam (SVG) and by the European Commission through the ‘OVAGE’ grant (QLK6-2000-00338).


    REFERENCES
 Top
 ABSTRACT
 Introduction
 Materials and methods
 Results
 Discussion
 REFERENCES
 
Baarends WM, Uilenbroek JT, Kramer P, Hoogerbrugge JW, van Leeuwen EC, Themmen AP and Grootegoed JA (1995) Anti-mullerian hormone and anti-mullerian hormone type II receptor messenger ribonucleic acid expression in rat ovaries during postnatal development, the estrous cycle and gonadotropin-induced follicle growth. Endocrinology 136,4951–4962.[Abstract]

Bezard J, Vigier B, Tran D, Mauleon P and Josso N (1987) Immunocytochemical study of anti-Mullerian hormone in sheep ovarian follicles during fetal and post-natal development. J Reprod Fertil 80,509–516.[Abstract/Free Full Text]

Blanchard DK and Hartmann LC (2000) Prophylactic surgery for women at high risk for breast cancer. Clin. Breast Cancer 1,127–134.[Medline]

Cate RL, Mattaliano RJ, Hession C, Tizard R, Farber NM, Cheung A, Ninfa EG, Frey AZ, Gash DJ, Chow EP et al. (1986) Isolation of the bovine and human genes for Mullerian inhibiting substance and expression of the human gene in animal cells. Cell 45,685–698.[CrossRef][Web of Science][Medline]

Cook CL, Siow Y, Brenner AG and Fallat ME (2002) Relationship between serum mullerian-inhibiting substance and other reproductive hormones in untreated women with polycystic ovary syndrome and normal women. Fertil Steril 77,141–146.[CrossRef][Web of Science][Medline]

deVet A, Laven JS, de Jong FH, Themmen AP and Fauser BC (2002) Antimullerian hormone serum levels: a putative marker for ovarian aging. Fertil Steril 77,357–362.[CrossRef][Web of Science][Medline]

Dissen GA, Romero C, Hirshfield AN and Ojeda SR (2001) Nerve growth factor is required for early follicular development in the mammalian ovary. Endocrinology 142,2078–2086.[Abstract/Free Full Text]

Durlinger AL, Kramer P, Karels B, de Jong FH, Uilenbroek JT, Grootegoed JA and Themmen AP (1999) Control of primordial follicle recruitment by anti-Mullerian hormone in the mouse ovary. Endocrinology 140,5789–5796.[Abstract/Free Full Text]

Durlinger AL, Gruijters MJ, Kramer P, Karels B, Kumar TR, Matzuk MM, Rose UM, de Jong FH, Uilenbroek JT, Grootegoed JA et al. (2001) Anti-Mullerian hormone attenuates the effects of FSH on follicle development in the mouse ovary. Endocrinology 142,4891–4899.[Abstract/Free Full Text]

Durlinger AL, Gruijters MJ, Kramer P, Karels B, Ingraham HA, Nachtigal MW, Uilenbroek JT, Grootegoed JA and Themmen AP (2002a) Anti-Mullerian hormone inhibits initiation of primordial follicle growth in the mouse ovary. Endocrinology 143,1076–1084.[Abstract/Free Full Text]

Durlinger AL, Visser JA and Themmen AP (2002b) Regulation of ovarian function: the role of anti-Mullerian hormone. Reproduction 124,601–609.[Abstract]

Fauser BC and van Heusden AM (1997) Manipulation of human ovarian function: physiological concepts and clinical consequences. Endocr Rev 18,71–106.[Abstract/Free Full Text]

Goding JW (1986) Monoclonal Antibodies: Principles & Practice. Academic Press, London, UK, pp. 141–191

Gougeon A (1986) Dynamics of follicular growth in the human: a model from preliminary results. Hum Reprod 1,81–87.[Abstract/Free Full Text]

Groome N and Lawrence M (1991) Preparation of monoclonal antibodies to the beta A subunit of ovarian inhibin using a synthetic peptide immunogen. Hybridoma 10,309–316.[Web of Science][Medline]

Grootegoed JA, Baarends WM and Themmen AP (1994) Welcome to the family: the anti-mullerian hormone receptor. Mol Cell Endocrinol 100,29–34.[CrossRef][Web of Science][Medline]

Harlow E and Lane D (1988) Antibodies. A Laboratory Manual. Cold Spring Harbor Laboratory, Cold Spring Harbor, NY, USA, pp. 310–311

Josso N, Picard JY and Tran D (1977) The anti-Mullerian hormone. Birth Defects Orig Artic Ser 13,59–84.[Medline]

Josso N, Racine C, di Clemente N, Rey R and Xavier F (1998) The role of anti-Mullerian hormone in gonadal development. Mol Cell Endocrinol 145,3–7.[CrossRef][Web of Science][Medline]

Kumar TR, Wang Y, Lu N and Matzuk MM (1997) Follicle stimulating hormone is required for ovarian follicle maturation but not male fertility. Nature Genet 15,201–204.[CrossRef][Web of Science][Medline]

Laven JS, Mulders A, de Jong FH, Themmen AP and Fauser BC (2003) Anti Mullerian Hormone (AMH): A novel marker for ovarian dysfunction in normogonadotropic anovulatory infertility. The Endocrine Society’s 85th annual meeting, June 19–22, 2003, Philadelphia, PA, USA. Abstract OR43-5.

McGee EA and Hsueh AJ (2000) Initial and cyclic recruitment of ovarian follicles. Endocr Rev 21,200–214.[Abstract/Free Full Text]

Nachtigal MW and Ingraham HA (1996) Bioactivation of Mullerian inhibiting substance during gonadal development by a kex2/subtilisin-like endoprotease. Proc Natl Acad Sci USA 93,7711–7716.[Abstract/Free Full Text]

Pache TD, Wladimiroff JW, de Jong FH, Hop WC and Fauser BC (1990) Growth patterns of nondominant ovarian follicles during the normal menstrual cycle. Fertil Steril 54,638–642.[Web of Science][Medline]

Parrott JA and Skinner MK (1999) Kit-ligand/stem cell factor induces primordial follicle development and initiates folliculogenesis. Endocrinology 140,4262–4271.[Abstract/Free Full Text]

Rajpert-DeMeyts E, Jorgensen N, Graem N, Muller J, Cate RL and Skakkebaek NE (1999) Expression of anti-Mullerian hormone during normal and pathological gonadal development: association with differentiation of Sertoli and granulosa cells. J Clin Endocrinol Metab 84,3836–3844.[Abstract/Free Full Text]

Richardson SJ and Nelson JF (1990) Follicular depletion during the menopausal transition. Ann NY Acad Sci 592,13–20.[Web of Science][Medline]

Schoot DC, Coelingh Bennink HJ, Mannaerts BM, Lamberts SW, Bouchard P and Fauser BC (1992) Human recombinant follicle-stimulating hormone induces growth of preovulatory follicles without concomitant increase in androgen and estrogen biosynthesis in a woman with isolated gonadotropin deficiency. J Clin Endocrinol Metab 74,1471–1473.[Abstract]

Te Velde ER and Pearson PL (2002) The variability of female reproductive ageing. Hum Reprod Update 8,141–154.[Abstract/Free Full Text]

Ueno S, Kuroda T, Maclaughlin DT, Ragin RC, Manganaro TF and Donahoe PK (1989a) Mullerian inhibiting substance in the adult rat ovary during various stages of the estrous cycle. Endocrinology 125,1060–1066.[Abstract/Free Full Text]

Ueno S, Takahashi M, Manganaro TF, Ragin RC and Donahoe PK (1989b) Cellular localization of mullerian inhibiting substance in the developing rat ovary. Endocrinology 124,1000–1006.[Abstract/Free Full Text]

van Cappellen WA, Meijs-Roelofs HM, Kramer P and Van den Dungen HM (1989) Ovarian follicle dynamics in immature rats treated with a luteinizing hormone-releasing hormone antagonist (Org. 30276). Biol Reprod 40,1247–1256.[Abstract]

van Rooij IA, Broekmans FJ, Te Velde ER, Fauser BC, Bancsi LF, de Jong FH and Themmen AP (2002) Serum anti-Mullerian hormone levels: a novel measure of ovarian reserve. Hum Reprod 17,3065–3071.[Abstract/Free Full Text]

van Santbrink EJ, Hop WC, van Dessel TJ, de Jong FH and Fauser BC (1995) Decremental follicle-stimulating hormone and dominant follicle development during the normal menstrual cycle. Fertil Steril 64,37–43.[Web of Science][Medline]

Submitted on October 6, 2003; accepted on October 20, 2003.


Add to CiteULike CiteULike   Add to Connotea Connotea   Add to Del.icio.us Del.icio.us    What's this?


This article has been cited by other articles:


Home page
Hum ReprodHome page
R. Homburg
Androgen circle of polycystic ovary syndrome
Hum. Reprod., July 1, 2009; 24(7): 1548 - 1555.
[Abstract] [Full Text] [PDF]


Home page
Hum ReprodHome page
A. La Marca, F.J. Broekmans, A. Volpe, B.C. Fauser, N.S. Macklon, and on behalf of the ESHRE Special Interest Group for
Anti-Mullerian hormone (AMH): what do we still need to know?
Hum. Reprod., June 11, 2009; (2009) dep210v1.
[Abstract] [Full Text] [PDF]


Home page
Hum ReprodHome page
S. Deb, M. Batcha, B.K. Campbell, K. Jayaprakasan, J.S. Clewes, J.F. Hopkisson, C. Sjoblom, and N.J. Raine-Fenning
The predictive value of the automated quantification of the number and size of small antral follicles in women undergoing ART
Hum. Reprod., June 3, 2009; (2009) dep204v1.
[Abstract] [Full Text] [PDF]


Home page
Eur J EndocrinolHome page
E. Diamanti-Kandarakis, A. Piouka, S. Livadas, C. Piperi, I. Katsikis, A. G Papavassiliou, and D. Panidis
Anti-mullerian hormone is associated with advanced glycosylated end products in lean women with polycystic ovary syndrome
Eur. J. Endocrinol., May 1, 2009; 160(5): 847 - 853.
[Abstract] [Full Text] [PDF]


Home page
Hum ReprodHome page
S. M. Nelson, R. W. Yates, H. Lyall, M. Jamieson, I. Traynor, M. Gaudoin, P. Mitchell, P. Ambrose, and R. Fleming
Anti-Mullerian hormone-based approach to controlled ovarian stimulation for assisted conception
Hum. Reprod., April 1, 2009; 24(4): 867 - 875.
[Abstract] [Full Text] [PDF]


Home page
J. Clin. Endocrinol. Metab.Home page
E. A. H. Knauff, M. J. C. Eijkemans, C. B. Lambalk, M. J. ten Kate-Booij, A. Hoek, C. C. M. Beerendonk, J. S. E. Laven, A. J. Goverde, F. J. M. Broekmans, A. P. N. Themmen, et al.
Anti-Mullerian Hormone, Inhibin B, and Antral Follicle Count in Young Women with Ovarian Failure
J. Clin. Endocrinol. Metab., March 1, 2009; 94(3): 786 - 792.
[Abstract] [Full Text] [PDF]


Home page
Biol. Reprod.Home page
C. Rico, S. Fabre, C. Medigue, N. d. Clemente, F. Clement, M. Bontoux, J.-L. Touze, M. Dupont, E. Briant, B. Remy, et al.
Anti-Mullerian Hormone Is an Endocrine Marker of Ovarian Gonadotropin-Responsive Follicles and Can Help to Predict Superovulatory Responses in the Cow
Biol Reprod, January 1, 2009; 80(1): 50 - 59.
[Abstract] [Full Text] [PDF]


Home page
Biol. Reprod.Home page
C. Pelusi, Y. Ikeda, M. Zubair, and K. L. Parker
Impaired Follicle Development and Infertility in Female Mice Lacking Steroidogenic Factor 1 in Ovarian Granulosa Cells
Biol Reprod, December 1, 2008; 79(6): 1074 - 1083.
[Abstract] [Full Text] [PDF]


Home page
J. Clin. Endocrinol. Metab.Home page
S. Catteau-Jonard, S. P. Jamin, A. Leclerc, J. Gonzales, D. Dewailly, and N. di Clemente
Anti-Mullerian Hormone, Its Receptor, FSH Receptor, and Androgen Receptor Genes Are Overexpressed by Granulosa Cells from Stimulated Follicles in Women with Polycystic Ovary Syndrome
J. Clin. Endocrinol. Metab., November 1, 2008; 93(11): 4456 - 4461.
[Abstract] [Full Text] [PDF]


Home page
Hum ReprodHome page
K. Jayaprakasan, B.K. Campbell, J.F. Hopkisson, J.S. Clewes, I.R. Johnson, and N.J. Raine-Fenning
Effect of pituitary desensitization on the early growing follicular cohort estimated using anti-Mullerian hormone
Hum. Reprod., November 1, 2008; 23(11): 2577 - 2583.
[Abstract] [Full Text] [PDF]


Home page
Hum ReprodHome page
M. Das, D.J. Gillott, E. Saridogan, and O. Djahanbakhch
Anti-Mullerian hormone is increased in follicular fluid from unstimulated ovaries in women with polycystic ovary syndrome
Hum. Reprod., September 1, 2008; 23(9): 2122 - 2126.
[Abstract] [Full Text] [PDF]


Home page
Biol. Reprod.Home page
A. Boyer, L. Hermo, M. Paquet, B. Robaire, and D. Boerboom
Seminiferous Tubule Degeneration and Infertility in Mice with Sustained Activation of WNT/CTNNB1 Signaling in Sertoli Cells
Biol Reprod, September 1, 2008; 79(3): 475 - 485.
[Abstract] [Full Text] [PDF]


Home page
ReproductionHome page
J C Sadeu, T Adriaenssens, and J Smitz
Expression of growth differentiation factor 9, bone morphogenetic protein 15, and anti-Mullerian hormone in cultured mouse primary follicles
Reproduction, August 1, 2008; 136(2): 195 - 203.
[Abstract] [Full Text] [PDF]


Home page
Biol. Reprod.Home page
D. Monniaux, N. d. Clemente, J.-L. Touze, C. Belville, C. Rico, M. Bontoux, J.-Y. Picard, and S. Fabre
Intrafollicular Steroids and Anti-Mullerian Hormone During Normal and Cystic Ovarian Follicular Development in the Cow
Biol Reprod, August 1, 2008; 79(2): 387 - 396.
[Abstract] [Full Text] [PDF]


Home page
J. Clin. Endocrinol. Metab.Home page
J. van Disseldorp, M. J. Faddy, A. P. N. Themmen, F. H. de Jong, P. H. M. Peeters, Y. T. van der Schouw, and F. J. M. Broekmans
Relationship of Serum Antimullerian Hormone Concentration to Age at Menopause
J. Clin. Endocrinol. Metab., June 1, 2008; 93(6): 2129 - 2134.
[Abstract] [Full Text] [PDF]


Home page
Hum ReprodHome page
J. Rohr, E.G. Allen, K. Charen, J. Giles, W. He, C. Dominguez, and S.L. Sherman
Anti-Mullerian hormone indicates early ovarian decline in fragile X mental retardation (FMR1) premutation carriers: a preliminary study
Hum. Reprod., May 1, 2008; 23(5): 1220 - 1225.
[Abstract] [Full Text] [PDF]


Home page
J. Clin. Endocrinol. Metab.Home page
M. E. Kevenaar, J. S. E. Laven, S. L. Fong, A. G. Uitterlinden, F. H. de Jong, A. P. N. Themmen, and J. A. Visser
A Functional Anti-Mullerian Hormone Gene Polymorphism Is Associated with Follicle Number and Androgen Levels in Polycystic Ovary Syndrome Patients
J. Clin. Endocrinol. Metab., April 1, 2008; 93(4): 1310 - 1316.
[Abstract] [Full Text] [PDF]


Home page
Hum ReprodHome page
M.-J. Chen, W.-S. Yang, C.-L. Chen, M.-Y. Wu, Y.-S. Yang, and H.-N. Ho
The relationship between anti-Mullerian hormone, androgen and insulin resistance on the number of antral follicles in women with polycystic ovary syndrome
Hum. Reprod., April 1, 2008; 23(4): 952 - 957.
[Abstract] [Full Text] [PDF]


Home page
Hum ReprodHome page
C. I. Durnerin, K. Erb, R. Fleming, H. Hillier, S.G. Hillier, C.M. Howles, J.-N. Hugues, A. Lass, H. Lyall, P. Rasmussen, et al.
Effects of recombinant LH treatment on folliculogenesis and responsiveness to FSH stimulation
Hum. Reprod., February 1, 2008; 23(2): 421 - 426.
[Abstract] [Full Text] [PDF]


Home page
Hum ReprodHome page
E. Arbo, D.V. Vetori, M.F. Jimenez, F.M. Freitas, N. Lemos, and J.S. Cunha-Filho
Serum anti-mullerian hormone levels and follicular cohort characteristics after pituitary suppression in the late luteal phase with oral contraceptive pills
Hum. Reprod., December 1, 2007; 22(12): 3192 - 3196.
[Abstract] [Full Text] [PDF]


Home page
J. Clin. Endocrinol. Metab.Home page
S. Catteau-Jonard, P. Pigny, A.-C. Reyss, C. Decanter, E. Poncelet, and D. Dewailly
Changes in Serum Anti-Mullerian Hormone Level during Low-Dose Recombinant Follicular-Stimulating Hormone Therapy for Anovulation in Polycystic Ovary Syndrome
J. Clin. Endocrinol. Metab., November 1, 2007; 92(11): 4138 - 4143.
[Abstract] [Full Text] [PDF]


Home page
Hum ReprodHome page
S. M. Nelson, R. W. Yates, and R. Fleming
Serum anti-Mullerian hormone and FSH: prediction of live birth and extremes of response in stimulated cycles implications for individualization of therapy
Hum. Reprod., September 1, 2007; 22(9): 2414 - 2421.
[Abstract] [Full Text] [PDF]


Home page
Hum ReprodHome page
M. E. Kevenaar, A. P.N. Themmen, F. Rivadeneira, A. G. Uitterlinden, J. S.E. Laven, N. M. van Schoor, P. Lips, H. A.P. Pols, and J. A. Visser
A polymorphism in the AMH type II receptor gene is associated with age at menopause in interaction with parity
Hum. Reprod., September 1, 2007; 22(9): 2382 - 2388.
[Abstract] [Full Text] [PDF]


Home page
The OncologistHome page
K. Oktay, M. Sonmezer, O. Oktem, K. Fox, G. Emons, and H. Bang
Absence of Conclusive Evidence for the Safety and Efficacy of Gonadotropin-Releasing Hormone Analogue Treatment in Protecting Against Chemotherapy-Induced Gonadal Injury
Oncologist, September 1, 2007; 12(9): 1055 - 1066.
[Abstract] [Full Text] [PDF]


Home page
ReproductionHome page
M.-M. Dolmans, B. Martinez-Madrid, E. Gadisseux, Y. Guiot, W. Y. Yuan, A. Torre, A. Camboni, A. Van Langendonckt, and J. Donnez
Short-term transplantation of isolated human ovarian follicles and cortical tissue into nude mice
Reproduction, August 1, 2007; 134(2): 253 - 262.
[Abstract] [Full Text] [PDF]


Home page
J. Clin. Endocrinol. Metab.Home page
G. E. Hale, X. Zhao, C. L. Hughes, H. G. Burger, D. M. Robertson, and I. S. Fraser
Endocrine Features of Menstrual Cycles in Middle and Late Reproductive Age and the Menopausal Transition Classified According to the Staging of Reproductive Aging Workshop (STRAW) Staging System
J. Clin. Endocrinol. Metab., August 1, 2007; 92(8): 3060 - 3067.
[Abstract] [Full Text] [PDF]


Home page
Hum ReprodHome page
M.L. Haadsma, A. Bukman, H. Groen, E.M.A. Roeloffzen, E.R. Groenewoud, M.J. Heineman, and A. Hoek
The number of small antral follicles (2-6 mm) determines the outcome of endocrine ovarian reserve tests in a subfertile population
Hum. Reprod., July 1, 2007; 22(7): 1925 - 1931.
[Abstract] [Full Text] [PDF]


Home page
Hum ReprodHome page
S. Tsepelidis, F. Devreker, I. Demeestere, A. Flahaut, Ch. Gervy, and Y. Englert
Stable serum levels of anti-Mullerian hormone during the menstrual cycle: a prospective study in normo-ovulatory women
Hum. Reprod., July 1, 2007; 22(7): 1837 - 1840.
[Abstract] [Full Text] [PDF]


Home page
Hum ReprodHome page
D. Dewailly, S. Catteau-Jonard, A.-C. Reyss, C. Maunoury-Lefebvre, E. Poncelet, and P. Pigny
The excess in 2-5 mm follicles seen at ovarian ultrasonography is tightly associated to the follicular arrest of the polycystic ovary syndrome
Hum. Reprod., June 1, 2007; 22(6): 1562 - 1566.
[Abstract] [Full Text] [PDF]


Home page
J. Clin. Endocrinol. Metab.Home page
D. S. Wachs, M. S. Coffler, P. J. Malcom, and R. J. Chang
Serum Anti-Mullerian Hormone Concentrations Are Not Altered by Acute Administration of Follicle Stimulating Hormone in Polycystic Ovary Syndrome and Normal Women
J. Clin. Endocrinol. Metab., May 1, 2007; 92(5): 1871 - 1874.
[Abstract] [Full Text] [PDF]


Home page
J. Clin. Endocrinol. Metab.Home page
R. Fanchin, D. H. Mendez Lozano, N. Frydman, A. Gougeon, N. di Clemente, R. Frydman, and J. Taieb
Anti-Mullerian Hormone Concentrations in the Follicular Fluid of the Preovulatory Follicle Are Predictive of the Implantation Potential of the Ensuing Embryo Obtained by in Vitro Fertilization
J. Clin. Endocrinol. Metab., May 1, 2007; 92(5): 1796 - 1802.
[Abstract] [Full Text] [PDF]


Home page
Hum Reprod UpdateHome page
A. L. Marca and A. Volpe
The Anti-Mullerian hormone and ovarian cancer
Hum. Reprod. Update, May 1, 2007; 13(3): 265 - 273.
[Abstract] [Full Text] [PDF]


Home page
EndocrinologyHome page
F. H. Thomas, E. E. Telfer, and H. M. Fraser
Expression of Anti-Mullerian Hormone Protein during Early Follicular Development in the Primate Ovary in Vivo Is Influenced by Suppression of Gonadotropin Secretion and Inhibition of Vascular Endothelial Growth Factor
Endocrinology, May 1, 2007; 148(5): 2273 - 2281.
[Abstract] [Full Text] [PDF]


Home page
J. Clin. Endocrinol. Metab.Home page
S. Rice, K. Ojha, S. Whitehead, and H. Mason
Stage-Specific Expression of Androgen Receptor, Follicle-Stimulating Hormone Receptor, and Anti-Mullerian Hormone Type II Receptor in Single, Isolated, Human Preantral Follicles: Relevance to Polycystic Ovaries
J. Clin. Endocrinol. Metab., March 1, 2007; 92(3): 1034 - 1040.
[Abstract] [Full Text] [PDF]


Home page
Hum ReprodHome page
A. La Marca, S. Giulini, A. Tirelli, E. Bertucci, T. Marsella, S. Xella, and A. Volpe
Anti-Mullerian hormone measurement on any day of the menstrual cycle strongly predicts ovarian response in assisted reproductive technology
Hum. Reprod., March 1, 2007; 22(3): 766 - 771.
[Abstract] [Full Text] [PDF]


Home page
Hum ReprodHome page
M. Sanchez, P. Alama, B. Gadea, S.R. Soares, C. Simon, and A. Pellicer
Fresh human orthotopic ovarian cortex transplantation: long-term results
Hum. Reprod., March 1, 2007; 22(3): 786 - 791.
[Abstract] [Full Text] [PDF]


Home page
J. Clin. Endocrinol. Metab.Home page
L. Pellatt, L. Hanna, M. Brincat, R. Galea, H. Brain, S. Whitehead, and H. Mason
Granulosa Cell Production of Anti-Mullerian Hormone Is Increased in Polycystic Ovaries
J. Clin. Endocrinol. Metab., January 1, 2007; 92(1): 240 - 245.
[Abstract] [Full Text] [PDF]


Home page
Hum ReprodHome page
G. Meduri, N. Massin, J. Guibourdenche, A. Bachelot, O. Fiori, F. Kuttenn, M. Misrahi, and P. Touraine
Serum anti-Mullerian hormone expression in women with premature ovarian failure
Hum. Reprod., January 1, 2007; 22(1): 117 - 123.
[Abstract] [Full Text] [PDF]


Home page
Hum ReprodHome page
A. La Marca, G. Stabile, A.C. Artenisio, and A. Volpe
Serum anti-Mullerian hormone throughout the human menstrual cycle
Hum. Reprod., December 1, 2006; 21(12): 3103 - 3107.
[Abstract] [Full Text] [PDF]


Home page
J. Clin. Endocrinol. Metab.Home page
W. J. K. Hehenkamp, C. W. N. Looman, A. P. N. Themmen, F. H. de Jong, E. R. te Velde, and F. J. M. Broekmans
Anti-Mullerian Hormone Levels in the Spontaneous Menstrual Cycle Do Not Show Substantial Fluctuation
J. Clin. Endocrinol. Metab., October 1, 2006; 91(10): 4057 - 4063.
[Abstract] [Full Text] [PDF]


Home page
Hum ReprodHome page
R.A. Anderson, A.P.N. Themmen, A.A. -Qahtani, N.P. Groome, and D.A. Cameron
The effects of chemotherapy and long-term gonadotrophin suppression on the ovarian reserve in premenopausal women with breast cancer
Hum. Reprod., October 1, 2006; 21(10): 2583 - 2592.
[Abstract] [Full Text] [PDF]


Home page
ReproductionHome page
D. Modi, D. Bhartiya, and C. Puri
Developmental expression and cellular distribution of Mullerian inhibiting substance in the primate ovary.
Reproduction, September 1, 2006; 132(3): 443 - 453.
[Abstract] [Full Text] [PDF]


Home page
Hum Reprod UpdateHome page
I. E. Messinis
Ovarian feedback, mechanism of action and possible clinical implications
Hum. Reprod. Update, September 1, 2006; 12(5): 557 - 571.
[Abstract] [Full Text] [PDF]


Home page
Hum ReprodHome page
I.B. Carlsson, J.E. Scott, J.A. Visser, O. Ritvos, A.P.N. Themmen, and O. Hovatta
Anti-Mullerian hormone inhibits initiation of growth of human primordial ovarian follicles in vitro
Hum. Reprod., September 1, 2006; 21(9): 2223 - 2227.
[Abstract] [Full Text] [PDF]


Home page
J. Clin. Endocrinol. Metab.Home page
T. Sir-Petermann, E. Codner, M. Maliqueo, B. Echiburu, C. Hitschfeld, N. Crisosto, F. Perez-Bravo, S. E. Recabarren, and F. Cassorla
Increased Anti-Mullerian Hormone Serum Concentrations in Prepubertal Daughters of Women with Polycystic Ovary Syndrome
J. Clin. Endocrinol. Metab., August 1, 2006; 91(8): 3105 - 3109.
[Abstract] [Full Text] [PDF]


Home page
Hum ReprodHome page
T. Ebner, M. Sommergruber, M. Moser, O. Shebl, E. Schreier-Lechner, and G. Tews
Basal level of anti-Mullerian hormone is associated with oocyte quality in stimulated cycles
Hum. Reprod., August 1, 2006; 21(8): 2022 - 2026.
[Abstract] [Full Text] [PDF]


Home page
EndocrinologyHome page
M. E. Kevenaar, M. F. Meerasahib, P. Kramer, B. M. N. van de Lang-Born, F. H. de Jong, N. P. Groome, A. P. N. Themmen, and J. A. Visser
Serum Anti-Mullerian Hormone Levels Reflect the Size of the Primordial Follicle Pool in Mice
Endocrinology, July 1, 2006; 147(7): 3228 - 3234.
[Abstract] [Full Text] [PDF]


Home page
Hum ReprodHome page
R. Fleming, N. Deshpande, I. Traynor, and R.W.S. Yates
Dynamics of FSH-induced follicular growth in subfertile women: relationship with age, insulin resistance, oocyte yield and anti-Mullerian hormone
Hum. Reprod., June 1, 2006; 21(6): 1436 - 1441.
[Abstract] [Full Text] [PDF]


Home page
J. Clin. Endocrinol. Metab.Home page
P. Pigny, S. Jonard, Y. Robert, and D. Dewailly
Serum Anti-Mullerian Hormone as a Surrogate for Antral Follicle Count for Definition of the Polycystic Ovary Syndrome
J. Clin. Endocrinol. Metab., March 1, 2006; 91(3): 941 - 945.
[Abstract] [Full Text] [PDF]


Home page
ReproductionHome page
J. A Visser, F. H de Jong, J. S E Laven, and A. P N Themmen
Anti-Mullerian hormone: a new marker for ovarian function
Reproduction, January 1, 2006; 131(1): 1 - 9.
[Abstract] [Full Text] [PDF]


Home page
J. Clin. Endocrinol. Metab.Home page
M. Anttonen, L. Unkila-Kallio, A. Leminen, R. Butzow, and M. Heikinheimo
High GATA-4 Expression Associates with Aggressive Behavior, whereas Low Anti-Mullerian Hormone Expression Associates with Growth Potential of Ovarian Granulosa Cell Tumors
J. Clin. Endocrinol. Metab., December 1, 2005; 90(12): 6529 - 6535.
[Abstract] [Full Text] [PDF]


Home page
J. Clin. Endocrinol. Metab.Home page
S. A. Stubbs, K. Hardy, P. Da Silva-Buttkus, J. Stark, L. J. Webber, A. M. Flanagan, A. P. N. Themmen, J. A. Visser, N. P. Groome, and S. Franks
Anti-Mullerian Hormone Protein Expression Is Reduced during the Initial Stages of Follicle Development in Human Polycystic Ovaries
J. Clin. Endocrinol. Metab., October 1, 2005; 90(10): 5536 - 5543.
[Abstract] [Full Text] [PDF]


Home page
Hum Reprod UpdateHome page
M. K. Skinner
Regulation of primordial follicle assembly and development
Hum. Reprod. Update, September 1, 2005; 11(5): 461 - 471.
[Abstract] [Full Text] [PDF]


Home page
ReproductionHome page
I Demeestere, J Centner, C Gervy, Y Englert, and A Delbaere
Impact of various endocrine and paracrine factors on in vitro culture of preantral follicles in rodents
Reproduction, August 1, 2005; 130(2): 147 - 156.
[Abstract] [Full Text] [PDF]


Home page
Hum Reprod UpdateHome page
N. Josso, C. Belville, N. di Clemente, and J.-Y. Picard
AMH and AMH receptor defects in persistent Mullerian duct syndrome
Hum. Reprod. Update, July 1, 2005; 11(4): 351 - 356.
[Abstract] [Full Text] [PDF]


Home page
Hum ReprodHome page
T. Eldar-Geva, E. J. Margalioth, M. Gal, A. Ben-Chetrit, N. Algur, E. Zylber-Haran, B. Brooks, M. Huerta, and I. M. Spitz
Serum anti-Mullerian hormone levels during controlled ovarian hyperstimulation in women with polycystic ovaries with and without hyperandrogenism
Hum. Reprod., July 1, 2005; 20(7): 1814 - 1819.
[Abstract] [Full Text] [PDF]


Home page
Hum ReprodHome page
T. Piltonen, L. Morin-Papunen, R. Koivunen, A. Perheentupa, A. Ruokonen, and J. S. Tapanainen
Serum anti-Mullerian hormone levels remain high until late reproductive age and decrease during metformin therapy in women with polycystic ovary syndrome
Hum. Reprod., July 1, 2005; 20(7): 1820 - 1826.
[Abstract] [Full Text] [PDF]


Home page
Hum Reprod UpdateHome page
ESHRE Capri Workshop Group
Fertility and ageing
Hum. Reprod. Update, May 1, 2005; 11(3): 261 - 276.
[Abstract] [Full Text] [PDF]


Home page
Hum ReprodHome page
R. Fanchin, J. Taieb, D. H. M. Lozano, B. Ducot, R. Frydman, and J. Bouyer
High reproducibility of serum anti-Mullerian hormone measurements suggests a multi-staged follicular secretion and strengthens its role in the assessment of ovarian follicular status
Hum. Reprod., April 1, 2005; 20(4): 923 - 927.
[Abstract] [Full Text] [PDF]


Home page
Hum ReprodHome page
J. Penarrubia, F. Fabregues, D. Manau, M. Creus, G. Casals, R. Casamitjana, F. Carmona, J. A. Vanrell, and J. Balasch
Basal and stimulation day 5 anti-Mullerian hormone serum concentrations as predictors of ovarian response and pregnancy in assisted reproductive technology cycles stimulated with gonadotropin-releasing hormone agonist-gonadotropin treatment
Hum. Reprod., April 1, 2005; 20(4): 915 - 922.
[Abstract] [Full Text] [PDF]


Home page
Hum ReprodHome page
R. Fanchin, D. H. Mendez Lozano, N. Louafi, N. Achour-Frydman, R. Frydman, and J. Taieb
Dynamics of serum anti-Mullerian hormone levels during the luteal phase of controlled ovarian hyperstimulation
Hum. Reprod., March 1, 2005; 20(3): 747 - 751.
[Abstract] [Full Text] [PDF]


Home page
J Natl Cancer Inst MonogrHome page
A. P. N. Themmen
Anti-Mullerian Hormone: Its Role in Follicular Growth Initiation and Survival and as an Ovarian Reserve Marker
J Natl Cancer Inst Monographs, March 1, 2005; 2005(34): 18 - 21.
[Abstract] [Full Text] [PDF]


Home page
Hum ReprodHome page
A. La Marca, S. Malmusi, S. Giulini, L. F. Tamaro, R. Orvieto, P. Levratti, and A. Volpe
Anti-Mullerian hormone plasma levels in spontaneous menstrual cycle and during treatment with FSH to induce ovulation
Hum. Reprod., December 1, 2004; 19(12): 2738 - 2741.
[Abstract] [Full Text] [PDF]


Home page
Hum ReprodHome page
D. Nikolaou and C. Gilling-Smith
Early ovarian ageing: are women with polycystic ovaries protected?
Hum. Reprod., October 1, 2004; 19(10): 2175 - 2179.
[Abstract] [Full Text] [PDF]


Home page
Hum ReprodHome page
A. G.M.G.J. Mulders, J. S.E. Laven, M. J.C. Eijkemans, F. H. de Jong, A. P.N. Themmen, and B. C.J.M. Fauser
Changes in anti-Mullerian hormone serum concentrations over time suggest delayed ovarian ageing in normogonadotrophic anovulatory infertility
Hum. Reprod., September 1, 2004; 19(9): 2036 - 2042.
[Abstract] [Full Text] [PDF]


Home page
Hum Reprod UpdateHome page
S. Jonard and D. Dewailly
The follicular excess in polycystic ovaries, due to intra-ovarian hyperandrogenism, may be the main culprit for the follicular arrest
Hum. Reprod. Update, March 1, 2004; 10(2): 107 - 117.
[Abstract] [Full Text] [PDF]


This Article
Right arrow Abstract Freely available
Right arrow FREE Full Text (PDF) Freely available
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Services
Right arrow Email this article to a friend
Right arrow Similar articles in this journal
Right arrow Similar articles in ISI Web of Science
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Add to My Personal Archive
Right arrow Download to citation manager
Right arrow Search for citing articles in:
ISI Web of Science (116)
Right arrowRequest Permissions
Google Scholar
Right arrow Articles by Weenen, C.
Right arrow Articles by Themmen, A. P.N.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Weenen, C.
Right arrow Articles by Themmen, A. P.N.
Social Bookmarking
 Add to CiteULike   Add to Connotea   Add to Del.icio.us  
What's this?